PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI10G13210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 392aa    MW: 42407.3 Da    PI: 6.8008
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI10G13210.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.74.3e-072492971462
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  14 ReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      R +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  ++ + ++
  OMERI10G13210.1 249 RQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSSGMATQ 297
                      89**********************************9999887766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147037.43E-17228290No hitNo description
SMARTSM003384.5E-9241300IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.0E-7249295No hitNo description
SuperFamilySSF579591.13E-6249290No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MNTTSANELM MHRHVQAAPY AAAPQQQGGK QRAPGLPPTP PPPPAAASSH SSHGDVCMDD  60
TARGGLLPPR KAHRRSRSDV PFGYFQPLPP PSPKMEAGGG WALPGCGGAG DVDLLNAYMS  120
LEGMGGADGL NNSDGDSRGS SMRTNGADSS ENESEDYVGA DSQALLWGGG EAAGKKRRNN  180
AAGEMAARHA RSLSMDSLMG KLSFAANGEP AKFSLEFGSG EFTPAEMKRI MADEKLAEMA  240
LADPKRVKRQ SAARSKERRM RYIAELEQKV QILQTEATTL SAQLTLLQRD SSGMATQNNE  300
LKFRLQSMEQ QAQLRDALNE ALTAEVQRLK LAANEVGDTS SSSNLAHQIQ LRCQNQMLDL  360
HKQQQQQVEQ IPFYQLEQPE QQNGTARNHE SK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086070.0AK108607.1 Oryza sativa Japonica Group cDNA clone:002-146-H05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613793.10.0PREDICTED: transcription factor RF2a-like
TrEMBLA0A0E0F0990.0A0A0E0F099_9ORYZ; Uncharacterized protein
STRINGLOC_Os10g38820.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-62bZIP family protein